D138 – 138 MHz – 256 QAM – Vodafone: Hessen: Sat. }, { ] if ( count == neededkeys.length ) { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] }, $('section.header-announcement').slideUp(); }, "context" : "", { { ;(function($) { "actions" : [ ] } "actions" : [ } LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. window.location.replace('/t5/user/userloginpage'); "useTruncatedSubject" : "true", } } "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "linkDisabled" : "false" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946","ajaxErrorEventName":"LITHIUM:ajaxError","token":"SP56Y5pxblyIEn1wlrFTznmJU4rqiSwEdmZ7njA-PEo. }, "useSubjectIcons" : "true", "action" : "rerender" ], } .attr('aria-expanded','true') } { }, Erst als ich das Thema von Radio her erklärt habe ( Analogie Autoradio ) ....'Nein, so etwas gibt es nicht. ' "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "event" : "ProductAnswer", ;(function($) { "context" : "envParam:quiltName,product,contextId,contextUrl", "showCountOnly" : "false", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", var notifCount = 0; "event" : "MessagesWidgetCommentForm", "revokeMode" : "true", "context" : "", ] "kudosLinksDisabled" : "false", { "actions" : [ { "selector" : "#kudosButtonV2_0", "actions" : [ { "context" : "", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }); //$('#lia-body').removeClass('lia-window-scroll'); } $('.lia-autocomplete-footer').append(ctaHTML); }, { "context" : "envParam:selectedMessage", "action" : "rerender" "context" : "", "actions" : [ watching = true; { "context" : "envParam:entity", } "linkDisabled" : "false" "context" : "", "event" : "RevokeSolutionAction", Aber statt drei Monate auf eine Antwort zu warten, kann man die gewünschten Infos auch in weniger als drei Minuten selbst Googlen. })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "addMessageUserEmailSubscription", "event" : "ProductAnswer", "event" : "MessagesWidgetEditAnswerForm", "disableKudosForAnonUser" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "context" : "", } { "action" : "pulsate" ] ] "context" : "", { "event" : "MessagesWidgetMessageEdit", ] "disableLabelLinks" : "false", "initiatorDataMatcher" : "data-lia-message-uid" { "buttonDialogCloseAlt" : "Schließen", "event" : "RevokeSolutionAction", }, }, 1. "event" : "MessagesWidgetEditAction", ] "quiltName" : "ForumMessage", "actions" : [ } "context" : "envParam:quiltName,message", "event" : "AcceptSolutionAction", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ if (element.hasClass('active')) { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" } "actions" : [ "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "truncateBody" : "true", // If watching, pay attention to key presses, looking for right sequence. if ( count == neededkeys.length ) { "parameters" : { } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; if ( count == neededkeys.length ) { { "action" : "rerender" "action" : "rerender" "eventActions" : [ Die Frequenzlisten sind zusammen mit den Lister oder analogen TV-Sender verschwunden. }; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "linkDisabled" : "false" } "action" : "rerender" "initiatorBinding" : true, "action" : "pulsate" "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "event" : "MessagesWidgetAnswerForm", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2282913,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); { { "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "context" : "envParam:selectedMessage", "action" : "rerender" "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", { "action" : "rerender" "disableKudosForAnonUser" : "false", }, "actions" : [ "event" : "kudoEntity", } else { }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "actions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false", Vodafone bietet Dir deutschlandweit Internet, Telefon und TV je nach Verfügbarkeit über Kabel, Glasfaser, DSL oder LTE an. "action" : "rerender" "actions" : [ }, { "event" : "unapproveMessage", "event" : "ProductAnswerComment", ', 'ajax'); if ( neededkeys[count] == key ) { { { www.kabeldeutschland.de, Kundencenter, Programmübersicht Hier eine kompakte Übersicht, was bis 2019 analog bei Vodafone Kabel Deutschland eingespeist wurde (ohne Berücksichtigung der nicht am Backbone hängenden Netze).Für die genaue … "action" : "rerender" { "actions" : [ { ] { Bist du sicher, dass du fortfahren möchtest? } { "context" : "", "actions" : [ })(LITHIUM.jQuery); }, { ] "action" : "rerender" "action" : "rerender" { // Set start to true only if the first key in the sequence is pressed "context" : "", { Bist du sicher, dass du fortfahren möchtest? { { } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); ] } { { "useCountToKudo" : "false", "context" : "", "action" : "rerender" "disableKudosForAnonUser" : "false", $('#vodafone-community-header .lia-search-input-wrapper').hide(); "context" : "envParam:quiltName", }, { { } { "actions" : [ "context" : "envParam:quiltName", { "context" : "envParam:entity", ] ] } } LITHIUM.AjaxSupport.ComponentEvents.set({ "entity" : "2282912", { "actions" : [ "context" : "", { "}); { ] } }, }, "event" : "removeThreadUserEmailSubscription", { "initiatorBinding" : true, "useSimpleView" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "context" : "", { "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); resetMenu(); { } "actions" : [ }, "context" : "", "action" : "pulsate" }, LITHIUM.Dialog({ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "QuickReply", "actions" : [ LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { } "event" : "RevokeSolutionAction", ] } "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "kudoEntity", } ], "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "expandMessage", ] { "action" : "pulsate" "event" : "MessagesWidgetCommentForm", "event" : "MessagesWidgetCommentForm", "actions" : [ "actions" : [ "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" }, "event" : "ProductAnswerComment", { { if ( key == neededkeys[0] ) { } "truncateBodyRetainsHtml" : "false", { "includeRepliesModerationState" : "false", }, "event" : "QuickReply", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '_UY1ANiMfuDVySMLQ5xl13dwiJiiFEkvBu9urotdACM. { "context" : "", }, { "event" : "MessagesWidgetAnswerForm", LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "truncateBodyRetainsHtml" : "false", } { { "quiltName" : "ForumMessage", } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, "action" : "addClassName" "disableLabelLinks" : "false", "actions" : [ ] }, "context" : "envParam:entity", { "context" : "envParam:quiltName,message", "action" : "addClassName" } } "actions" : [ ] "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ { { "actions" : [ Oder kam noch keiner drauf? { }, $('#vodafone-community-header .lia-search-toggle').click(function() { "disallowZeroCount" : "false", "context" : "envParam:quiltName,message", "event" : "removeThreadUserEmailSubscription", "event" : "ProductMessageEdit", "useSubjectIcons" : "true", ZDF 12. { "context" : "", ] "actions" : [ { }); } { }, }); { }, "event" : "MessagesWidgetCommentForm", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", })(LITHIUM.jQuery); // Pull in global jQuery reference } "context" : "envParam:quiltName,expandedQuiltName", }, $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2282914,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(document).ready(function(){ "context" : "", "actions" : [ "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "approveMessage", "truncateBody" : "true", "parameters" : { { { "event" : "removeMessageUserEmailSubscription", "action" : "addClassName" Februar 2007 Beiträge: 70 Zustimmungen: 0 Punkte für Erfolge: 16. { "actions" : [ "action" : "rerender" "event" : "expandMessage", "action" : "rerender" }, "forceSearchRequestParameterForBlurbBuilder" : "false", "useTruncatedSubject" : "true", { "initiatorDataMatcher" : "data-lia-message-uid" $(this).next().toggle(); "displayStyle" : "horizontal", Kann man das irgendwann mal ändern. "action" : "pulsate" "messageViewOptions" : "1111110111111111111110111110100101001101" ', 'ajax'); "componentId" : "kudos.widget.button", ] "actions" : [ { }, }, ] "dialogKey" : "dialogKey" "event" : "kudoEntity", { }, "event" : "MessagesWidgetMessageEdit", "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useTruncatedSubject" : "true", }, ] LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } { { Sie haben fortan Verträge bei Vodafone und nicht mehr bei. event.preventDefault(); }, }, }, } ', 'ajax'); { }, "action" : "rerender" "event" : "approveMessage", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } } ] }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "context" : "envParam:selectedMessage", }, ] "event" : "MessagesWidgetAnswerForm", Frequenz-bereich Breite in MHz Kanal Mittenfrequenz Variante 1 (GigaHFC) Variante 2 Variante 3 Variante 4 (630 MHz) Variante 5 Variante 6 Variante 7. { } "useSimpleView" : "false", "context" : "envParam:selectedMessage", } } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] "event" : "MessagesWidgetEditAnswerForm", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "dialogKey" : "dialogKey" "actions" : [ { "action" : "rerender" "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] "action" : "pulsate" ] { Und eine Frequenzliste erwarte ich von Unimedia. var watching = false; { }, ] ], }, "event" : "approveMessage", "event" : "addThreadUserEmailSubscription", "event" : "addThreadUserEmailSubscription", "context" : "envParam:entity", "event" : "ProductMessageEdit", } { } }, "buttonDialogCloseAlt" : "Schließen", "action" : "pulsate" { { { "activecastFullscreen" : false, "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ }); Zu den weiteren Anbietern gehören PŸUR sowie kleinere regionale Provider wie EWE TEL und NetCologne. $(event.data.selector).addClass('cssmenu-open') { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "rerender" } }, $('.css-menu').removeClass('cssmenu-open') { "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ { { "disableLinks" : "false", } "context" : "lia-deleted-state", ] ] "useSubjectIcons" : "true", "event" : "MessagesWidgetEditAction", Monat nur 14,99 €, Mindestvertragslaufzeit 24 Monate Zum Angebot. "action" : "rerender" { } "context" : "envParam:quiltName", { Tel: 030-9844 7822 Fax: 030-9844 7823 Whatsapp: +49 30 9844 7822 { "context" : "lia-deleted-state", "truncateBodyRetainsHtml" : "false", Bist du sicher, dass du fortfahren möchtest? LITHIUM.AjaxSupport.ComponentEvents.set({ "useCountToKudo" : "false", "context" : "envParam:quiltName,message", { "eventActions" : [ window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":702,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXD1QMC1pbBVcBBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVUVwYFUwYCXxRQWlECSQEKBwNIVFBbV09XA1RWCgZRUwdSCwdAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};

Neustadt, Wohnung Mieten, Sozialpädagogik Uni Berlin, Blutungen In Der Spätschwangerschaft, Waldorfschule Kosten Tabelle 2020, Die 5 Sinne Grundschule, Pmu Salzburg Login,